Lineage for d2k6na1 (2k6n A:11-76)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697673Fold a.14: VHP, Villin headpiece domain [47049] (1 superfamily)
    3 short helices; irregular array
  4. 2697674Superfamily a.14.1: VHP, Villin headpiece domain [47050] (2 families) (S)
  5. 2697708Family a.14.1.0: automated matches [254251] (1 protein)
    not a true family
  6. 2697709Protein automated matches [254571] (2 species)
    not a true protein
  7. 2697710Species Human (Homo sapiens) [TaxId:9606] [255323] (3 PDB entries)
  8. 2697712Domain d2k6na1: 2k6n A:11-76 [242389]
    Other proteins in same PDB: d2k6na2
    automated match to d2rjya_

Details for d2k6na1

PDB Entry: 2k6n (more details)

PDB Description: solution structure of human supervillin headpiece, minimized average
PDB Compounds: (A:) Supervillin

SCOPe Domain Sequences for d2k6na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k6na1 a.14.1.0 (A:11-76) automated matches {Human (Homo sapiens) [TaxId: 9606]}
laklcktiypladllarplpegvdplkleiyltdedfefaldmtrdeynalpawkqvnlk
kakglf

SCOPe Domain Coordinates for d2k6na1:

Click to download the PDB-style file with coordinates for d2k6na1.
(The format of our PDB-style files is described here.)

Timeline for d2k6na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2k6na2