Lineage for d2k6ms_ (2k6m S:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1482277Fold a.14: VHP, Villin headpiece domain [47049] (1 superfamily)
    3 short helices; irregular array
  4. 1482278Superfamily a.14.1: VHP, Villin headpiece domain [47050] (2 families) (S)
  5. 1482312Family a.14.1.0: automated matches [254251] (1 protein)
    not a true family
  6. 1482313Protein automated matches [254571] (1 species)
    not a true protein
  7. 1482314Species Human (Homo sapiens) [TaxId:9606] [255323] (3 PDB entries)
  8. 1482317Domain d2k6ms_: 2k6m S: [242388]
    automated match to d2rjya_

Details for d2k6ms_

PDB Entry: 2k6m (more details)

PDB Description: solution structure of human supervillin headpiece
PDB Compounds: (S:) Supervillin

SCOPe Domain Sequences for d2k6ms_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k6ms_ a.14.1.0 (S:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlaklcktiypladllarplpegvdplkleiyltdedfefaldmtrdeynalpawkqvnl
kkakglf

SCOPe Domain Coordinates for d2k6ms_:

Click to download the PDB-style file with coordinates for d2k6ms_.
(The format of our PDB-style files is described here.)

Timeline for d2k6ms_: