SCOPe 2.08: Domain d2k6ms1: 2k6m S:11-76

Lineage for d2k6ms1 (2k6m S:11-76)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.14: VHP, Villin headpiece domain [47049] (1 superfamily)
   3 short helices; irregular array

4. Superfamily a.14.1: VHP, Villin headpiece domain [47050] (2 families)

5. Family a.14.1.0: automated matches [254251] (1 protein)
   not a true family

6. Protein automated matches [254571] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255323] (3 PDB entries)

8. Domain d2k6ms1: 2k6m S:11-76 [242388]
   Other proteins in same PDB: d2k6ms2
   automated match to d2rjya_

Details for d2k6ms1

PDB Entry: 2k6m

PDB Description: solution structure of human supervillin headpiece

PDB Compounds: (S:) Supervillin

SCOPe Domain Sequences for d2k6ms1:

Sequence; same for both SEQRES and ATOM records:

>d2k6ms1 a.14.1.0 (S:11-76) automated matches {Human (Homo sapiens) [TaxId: 9606]}
laklcktiypladllarplpegvdplkleiyltdedfefaldmtrdeynalpawkqvnlk
kakglf

Timeline for d2k6ms1:

• d2k6ms1 first appeared in SCOPe 2.04, called d2k6ms_
  
• d2k6ms1 appears in SCOPe 2.07