| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.14: VHP, Villin headpiece domain [47049] (1 superfamily) 3 short helices; irregular array |
Superfamily a.14.1: VHP, Villin headpiece domain [47050] (2 families) ![]() |
| Family a.14.1.0: automated matches [254251] (1 protein) not a true family |
| Protein automated matches [254571] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255323] (3 PDB entries) |
| Domain d2k6ms1: 2k6m S:11-76 [242388] Other proteins in same PDB: d2k6ms2 automated match to d2rjya_ |
PDB Entry: 2k6m (more details)
SCOPe Domain Sequences for d2k6ms1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k6ms1 a.14.1.0 (S:11-76) automated matches {Human (Homo sapiens) [TaxId: 9606]}
laklcktiypladllarplpegvdplkleiyltdedfefaldmtrdeynalpawkqvnlk
kakglf
Timeline for d2k6ms1: