Class a: All alpha proteins [46456] (290 folds) |
Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies) core: 3 helices; bundle, open |
Superfamily a.23.5: Hemolysin expression modulating protein HHA [68989] (2 families) automatically mapped to Pfam PF05321 |
Family a.23.5.1: Hemolysin expression modulating protein HHA [68990] (2 proteins) |
Protein automated matches [196791] (2 species) not a true protein |
Species Yersinia pestis [TaxId:632] [255322] (2 PDB entries) |
Domain d2k5sa1: 2k5s A:2-67 [242382] Other proteins in same PDB: d2k5sa2, d2k5sa3 automated match to d4icgc_ |
PDB Entry: 2k5s (more details)
SCOPe Domain Sequences for d2k5sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k5sa1 a.23.5.1 (A:2-67) automated matches {Yersinia pestis [TaxId: 632]} tktdylmrlrkcttidtlervieknkyelsddelelfysaadhrlaeltmnklydkippt vwqhvk
Timeline for d2k5sa1: