Lineage for d2k5sa1 (2k5s A:2-67)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699273Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 2699409Superfamily a.23.5: Hemolysin expression modulating protein HHA [68989] (2 families) (S)
    automatically mapped to Pfam PF05321
  5. 2699410Family a.23.5.1: Hemolysin expression modulating protein HHA [68990] (2 proteins)
  6. 2699416Protein automated matches [196791] (2 species)
    not a true protein
  7. 2699420Species Yersinia pestis [TaxId:632] [255322] (2 PDB entries)
  8. 2699421Domain d2k5sa1: 2k5s A:2-67 [242382]
    Other proteins in same PDB: d2k5sa2, d2k5sa3
    automated match to d4icgc_

Details for d2k5sa1

PDB Entry: 2k5s (more details)

PDB Description: ymoa
PDB Compounds: (A:) Modulating protein ymoA

SCOPe Domain Sequences for d2k5sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k5sa1 a.23.5.1 (A:2-67) automated matches {Yersinia pestis [TaxId: 632]}
tktdylmrlrkcttidtlervieknkyelsddelelfysaadhrlaeltmnklydkippt
vwqhvk

SCOPe Domain Coordinates for d2k5sa1:

Click to download the PDB-style file with coordinates for d2k5sa1.
(The format of our PDB-style files is described here.)

Timeline for d2k5sa1: