SCOP 1.71: Domain d1sacb_: 1sac B:

Lineage for d1sacb_ (1sac B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families)

5. Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)

6. Protein Serum amyloid P component (SAP) [49952] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49953] (3 PDB entries)

8. Domain d1sacb_: 1sac B: [24238]

Details for d1sacb_

PDB Entry: 1sac, 2 Å

PDB Description: the structure of pentameric human serum amyloid p component

SCOP Domain Sequences for d1sacb_:

Sequence; same for both SEQRES and ATOM records:

>d1sacb_ b.29.1.5 (B:) Serum amyloid P component (SAP) {Human (Homo sapiens)}
htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
nildwqalnyeirgyviikplvwv

Timeline for d1sacb_:

• d1sacb_ first appeared (with stable ids) in SCOP 1.55
  
• d1sacb_ appears in SCOP 1.69
  
• d1sacb_ appears in SCOP 1.73
  
• d1sacb_ appears in the current release, SCOPe 2.08