Lineage for d2k4ja1 (2k4j A:13-115)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695233Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 2695324Family a.4.6.0: automated matches [191513] (1 protein)
    not a true family
  6. 2695325Protein automated matches [190858] (25 species)
    not a true protein
  7. 2695347Species Helicobacter pylori [TaxId:85963] [255221] (3 PDB entries)
  8. 2695348Domain d2k4ja1: 2k4j A:13-115 [242376]
    Other proteins in same PDB: d2k4ja2
    automated match to d1odda_

Details for d2k4ja1

PDB Entry: 2k4j (more details)

PDB Description: arsr dna binding domain
PDB Compounds: (A:) Putative transcriptional regulator

SCOPe Domain Sequences for d2k4ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k4ja1 a.4.6.0 (A:13-115) automated matches {Helicobacter pylori [TaxId: 85963]}
eevsepgdanifrvdkdsrevymhekkldltraeyeilslliskkgyvfsresiaieses
inpessnksidviigrlrskieknpkqpqyiisvrgigykley

SCOPe Domain Coordinates for d2k4ja1:

Click to download the PDB-style file with coordinates for d2k4ja1.
(The format of our PDB-style files is described here.)

Timeline for d2k4ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2k4ja2