Lineage for d2k4ia_ (2k4i A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2716789Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
    4-5 helices; right-handed superhelix
  4. 2716790Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) (S)
    the 5th, C-terminal helix is missing in some of the member structures
  5. 2716791Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (3 proteins)
    automatically mapped to Pfam PF00540
  6. 2716825Protein automated matches [228657] (4 species)
    not a true protein
  7. 2716835Species Human immunodeficiency virus type 2 [TaxId:11720] [255318] (3 PDB entries)
  8. 2716836Domain d2k4ia_: 2k4i A: [242375]
    automated match to d2hmxa_
    complexed with myr, pbu

Details for d2k4ia_

PDB Entry: 2k4i (more details)

PDB Description: Solution structure of HIV-2 myrMA bound to di-C4-PI(4,5)P2
PDB Compounds: (A:) HIV-2 myristoylated matrix protein

SCOPe Domain Sequences for d2k4ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k4ia_ a.61.1.1 (A:) automated matches {Human immunodeficiency virus type 2 [TaxId: 11720]}
garnsvlrgkkadelerirlrpggkkkyrlkhivwaankldrfglaeslleskegcqkil
tvldpmvptgsenlkslfntvcviwcihaeekvkdtegakqivrrhlvaetgtaekmpst
srptapssekggny

SCOPe Domain Coordinates for d2k4ia_:

Click to download the PDB-style file with coordinates for d2k4ia_.
(The format of our PDB-style files is described here.)

Timeline for d2k4ia_: