Class a: All alpha proteins [46456] (290 folds) |
Fold a.61: Retroviral matrix proteins [47835] (1 superfamily) 4-5 helices; right-handed superhelix |
Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) the 5th, C-terminal helix is missing in some of the member structures |
Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (3 proteins) automatically mapped to Pfam PF00540 |
Protein automated matches [228657] (4 species) not a true protein |
Species Human immunodeficiency virus type 2 [TaxId:11720] [255318] (3 PDB entries) |
Domain d2k4ha_: 2k4h A: [242374] automated match to d2hmxa_ complexed with myr |
PDB Entry: 2k4h (more details)
SCOPe Domain Sequences for d2k4ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k4ha_ a.61.1.1 (A:) automated matches {Human immunodeficiency virus type 2 [TaxId: 11720]} garnsvlrgkkadelerirlrpggkkkyrlkhivwaankldrfglaeslleskegcqkil tvldpmvptgsenlkslfntvcviwcihaeekvkdtegakqivrrhlvaetgtaekmpst srptapssekggny
Timeline for d2k4ha_: