Lineage for d2k4ea_ (2k4e A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325440Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
    4-5 helices; right-handed superhelix
  4. 2325441Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) (S)
    the 5th, C-terminal helix is missing in some of the member structures
  5. 2325442Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (3 proteins)
    automatically mapped to Pfam PF00540
  6. 2325464Protein automated matches [228657] (4 species)
    not a true protein
  7. 2325474Species Human immunodeficiency virus type 2 [TaxId:11720] [255318] (3 PDB entries)
  8. 2325476Domain d2k4ea_: 2k4e A: [242373]
    automated match to d2hmxa_

Details for d2k4ea_

PDB Entry: 2k4e (more details)

PDB Description: solution structure of the hiv-2 unmyristoylated matrix protein
PDB Compounds: (A:) HIV-2 unmyristoylated matrix protein

SCOPe Domain Sequences for d2k4ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k4ea_ a.61.1.1 (A:) automated matches {Human immunodeficiency virus type 2 [TaxId: 11720]}
garnsvlrgkkadelerirlrpggkkkyrlkhivwaankldrfglaeslleskegcqkil
tvldpmvptgsenlkslfntvcviwcihaeekvkdtegakqivrrhlvaetgtaekmpst
srptapssekggny

SCOPe Domain Coordinates for d2k4ea_:

Click to download the PDB-style file with coordinates for d2k4ea_.
(The format of our PDB-style files is described here.)

Timeline for d2k4ea_: