SCOPe 2.08: Domain d2k4ea_: 2k4e A:

Lineage for d2k4ea_ (2k4e A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
   4-5 helices; right-handed superhelix

4. Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families)
   the 5th, C-terminal helix is missing in some of the member structures

5. Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (3 proteins)
   automatically mapped to Pfam PF00540

6. Protein automated matches [228657] (4 species)
   not a true protein

7. Species Human immunodeficiency virus type 2 [TaxId:11720] [255318] (3 PDB entries)

8. Domain d2k4ea_: 2k4e A: [242373]
   automated match to d2hmxa_

Details for d2k4ea_

PDB Entry: 2k4e

PDB Description: solution structure of the hiv-2 unmyristoylated matrix protein

PDB Compounds: (A:) HIV-2 unmyristoylated matrix protein

SCOPe Domain Sequences for d2k4ea_:

Sequence; same for both SEQRES and ATOM records:

>d2k4ea_ a.61.1.1 (A:) automated matches {Human immunodeficiency virus type 2 [TaxId: 11720]}
garnsvlrgkkadelerirlrpggkkkyrlkhivwaankldrfglaeslleskegcqkil
tvldpmvptgsenlkslfntvcviwcihaeekvkdtegakqivrrhlvaetgtaekmpst
srptapssekggny

Timeline for d2k4ea_:

• d2k4ea_ first appeared in SCOPe 2.04
  
• d2k4ea_ appears in SCOPe 2.07