Lineage for d2k4ab_ (2k4a B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1790651Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1790652Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 1790653Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 1790654Protein Acidic FGF (FGF1) [50357] (4 species)
  7. 1790668Species Human (Homo sapiens) [TaxId:9606] [50359] (92 PDB entries)
    Uniprot P05230 16-152 ! Uniprot P05230
  8. 1790880Domain d2k4ab_: 2k4a B: [242372]
    Other proteins in same PDB: d2k4aa_
    automated match to d1djsb_

Details for d2k4ab_

PDB Entry: 2k4a (more details)

PDB Description: fgf-1-c2a binary complex structure: a key component in the fibroblast growthfactor non-classical pathway
PDB Compounds: (B:) heparin-binding growth factor 1

SCOPe Domain Sequences for d2k4ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k4ab_ b.42.1.1 (B:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
ykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylam
dtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygq
kailflplpvssd

SCOPe Domain Coordinates for d2k4ab_:

Click to download the PDB-style file with coordinates for d2k4ab_.
(The format of our PDB-style files is described here.)

Timeline for d2k4ab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2k4aa_