SCOPe 2.04: Domain d2k4aa_: 2k4a A:

Lineage for d2k4aa_ (2k4a A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families)
   two constituent families are related by circular permutation

5. Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
   topologically similar to the C-terminal domain of PapD

6. Protein Synaptogamin I [49576] (2 species)
   duplication: contains tandem repeat of two similar domains

7. Species Human (Homo sapiens) [TaxId:9606] [158946] (10 PDB entries)

8. Domain d2k4aa_: 2k4a A: [242371]
   Other proteins in same PDB: d2k4ab_
   automated match to d1byna_

Details for d2k4aa_

PDB Entry: 2k4a

PDB Description: fgf-1-c2a binary complex structure: a key component in the fibroblast growthfactor non-classical pathway

PDB Compounds: (A:) Synaptotagmin-1

SCOPe Domain Sequences for d2k4aa_:

Sequence; same for both SEQRES and ATOM records:

>d2k4aa_ b.7.1.2 (A:) Synaptogamin I {Human (Homo sapiens) [TaxId: 9606]}
eklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhr
ktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteew
rdlqsaek

Timeline for d2k4aa_:

• d2k4aa_ is new in SCOPe 2.04-stable
  
• d2k4aa_ appears in SCOPe 2.05
  
• d2k4aa_ appears in the current release, SCOPe 2.08