![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) ![]() two constituent families are related by circular permutation |
![]() | Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins) topologically similar to the C-terminal domain of PapD |
![]() | Protein Synaptogamin I [49576] (3 species) duplication: contains tandem repeat of two similar domains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [158946] (14 PDB entries) |
![]() | Domain d2k4aa_: 2k4a A: [242371] Other proteins in same PDB: d2k4ab_ automated match to d1byna_ |
PDB Entry: 2k4a (more details)
SCOPe Domain Sequences for d2k4aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k4aa_ b.7.1.2 (A:) Synaptogamin I {Human (Homo sapiens) [TaxId: 9606]} eklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhr ktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteew rdlqsaek
Timeline for d2k4aa_: