SCOPe 2.07: Domain d2k43a_: 2k43 A:

Lineage for d2k43a_ (2k43 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (94 PDB entries)
   Uniprot P05230 16-152 ! Uniprot P05230

8. Domain d2k43a_: 2k43 A: [242369]
   automated match to d1djsb_

Details for d2k43a_

PDB Entry: 2k43

PDB Description: acidic fibroblast growth factor solution structure in the fgf-1-c2a binary complex: key component in the fibroblast growthfactor non- classical pathway

PDB Compounds: (A:) heparin-binding growth factor 1

SCOPe Domain Sequences for d2k43a_:

Sequence; same for both SEQRES and ATOM records:

>d2k43a_ b.42.1.1 (A:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
ykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylam
dtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygq
kailflplpvssd

Timeline for d2k43a_:

• d2k43a_ first appeared in SCOPe 2.04
  
• d2k43a_ appears in SCOPe 2.06
  
• d2k43a_ appears in the current release, SCOPe 2.08