![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.14: MIT domain [116846] (2 families) ![]() |
![]() | Family a.7.14.0: automated matches [191520] (1 protein) not a true family |
![]() | Protein automated matches [190877] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [226520] (3 PDB entries) |
![]() | Domain d2k3wa_: 2k3w A: [242367] automated match to d4niqa_ |
PDB Entry: 2k3w (more details)
SCOPe Domain Sequences for d2k3wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k3wa_ a.7.14.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tstlqkaidlvtkateedkaknyeealrlyqhaveyflhaikyeahsdkakesirakcvq yldraeklkdylr
Timeline for d2k3wa_: