Class a: All alpha proteins [46456] (290 folds) |
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) duplication: contains multiple CxxCH motifs |
Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins) the main characteristic feature of this motif is the packing of its two hemes many members contains one or more complete motifs flanked by incomplete motifs and/or other domains |
Protein automated matches [190276] (12 species) not a true protein |
Species Shewanella frigidimarina [TaxId:318167] [255317] (1 PDB entry) |
Domain d2k3va_: 2k3v A: [242366] automated match to d1m1ra_ complexed with hec |
PDB Entry: 2k3v (more details)
SCOPe Domain Sequences for d2k3va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k3va_ a.138.1.3 (A:) automated matches {Shewanella frigidimarina [TaxId: 318167]} adetlaefhvemggcenchadgepskdgayefeqcqschgslaemddnhkphdgllmcad chapheakvgekptcdtchddgrtak
Timeline for d2k3va_: