Lineage for d2k3va_ (2k3v A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734165Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2734166Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2734319Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 2734414Protein automated matches [190276] (12 species)
    not a true protein
  7. 2734476Species Shewanella frigidimarina [TaxId:318167] [255317] (1 PDB entry)
  8. 2734477Domain d2k3va_: 2k3v A: [242366]
    automated match to d1m1ra_
    complexed with hec

Details for d2k3va_

PDB Entry: 2k3v (more details)

PDB Description: solution structure of a tetrahaem cytochrome from shewanella frigidimarina
PDB Compounds: (A:) Tetraheme cytochrome c-type

SCOPe Domain Sequences for d2k3va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k3va_ a.138.1.3 (A:) automated matches {Shewanella frigidimarina [TaxId: 318167]}
adetlaefhvemggcenchadgepskdgayefeqcqschgslaemddnhkphdgllmcad
chapheakvgekptcdtchddgrtak

SCOPe Domain Coordinates for d2k3va_:

Click to download the PDB-style file with coordinates for d2k3va_.
(The format of our PDB-style files is described here.)

Timeline for d2k3va_: