Lineage for d2k3ha_ (2k3h A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2045100Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2045101Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2045347Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 2045348Protein automated matches [190497] (4 species)
    not a true protein
  7. 2045378Species Mouse (Mus musculus) [TaxId:10090] [187441] (3 PDB entries)
  8. 2045382Domain d2k3ha_: 2k3h A: [242364]
    automated match to d2chda_
    complexed with ca

Details for d2k3ha_

PDB Entry: 2k3h (more details)

PDB Description: structural determinants for ca2+ and pip2 binding by the c2a domain of rabphilin-3a
PDB Compounds: (A:) rabphilin-3a

SCOPe Domain Sequences for d2k3ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k3ha_ b.7.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
galefsllydqdnsnlqctiirakglkpmdsngladpyvklhllpgasksnklrtktlrn
trnpvwnetlqyhgiteedmqrktlrisvcdedkfghnefigetrfslkklkanqrknfn
iclervi

SCOPe Domain Coordinates for d2k3ha_:

Click to download the PDB-style file with coordinates for d2k3ha_.
(The format of our PDB-style files is described here.)

Timeline for d2k3ha_: