Lineage for d2k3ga_ (2k3g A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1962063Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 1962064Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 1962288Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 1962289Protein BMP receptor Ia ectodomain [57359] (1 species)
  7. 1962290Species Human (Homo sapiens) [TaxId:9606] [57360] (11 PDB entries)
  8. 1962311Domain d2k3ga_: 2k3g A: [242363]
    automated match to d1rewd_

Details for d2k3ga_

PDB Entry: 2k3g (more details)

PDB Description: nmr structure analysis of a bmp receptor
PDB Compounds: (A:) Bone morphogenetic protein receptor type-1A

SCOPe Domain Sequences for d2k3ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k3ga_ g.7.1.3 (A:) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]}
gpedtlpflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqc
kdspkaqlrrtieccrtnlcnqylqptlppvvigpffdgsir

SCOPe Domain Coordinates for d2k3ga_:

Click to download the PDB-style file with coordinates for d2k3ga_.
(The format of our PDB-style files is described here.)

Timeline for d2k3ga_: