Class a: All alpha proteins [46456] (285 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) |
Family a.28.1.2: Peptidyl carrier domain [47342] (1 protein) |
Protein Peptidyl carrier protein (PCP), thioester domain [47343] (1 species) |
Species Bacillus brevis [TaxId:1393] [47344] (6 PDB entries) |
Domain d2k2qa_: 2k2q A: [242360] automated match to d1dnya_ |
PDB Entry: 2k2q (more details)
SCOPe Domain Sequences for d2k2qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k2qa_ a.28.1.2 (A:) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]} mgvteaqyvaptnavesklaeiwervlgvsgigildnffqigghslkamavaaqvhreyq velplkvlfaqptikalaqyva
Timeline for d2k2qa_: