SCOPe 2.08: Domain d2k2qa1: 2k2q A:3-82

Lineage for d2k2qa1 (2k2q A:3-82)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.2: Peptidyl carrier domain [47342] (1 protein)

6. Protein Peptidyl carrier protein (PCP), thioester domain [47343] (1 species)

7. Species Bacillus brevis [TaxId:1393] [47344] (7 PDB entries)

8. Domain d2k2qa1: 2k2q A:3-82 [242360]
   Other proteins in same PDB: d2k2qa2
   automated match to d1dnya_

Details for d2k2qa1

PDB Entry: 2k2q

PDB Description: complex structure of the external thioesterase of the surfactin- synthetase with a carrier domain

PDB Compounds: (A:) Tyrocidine synthetase 3 (Tyrocidine synthetase III)

SCOPe Domain Sequences for d2k2qa1:

Sequence; same for both SEQRES and ATOM records:

>d2k2qa1 a.28.1.2 (A:3-82) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]}
vteaqyvaptnavesklaeiwervlgvsgigildnffqigghslkamavaaqvhreyqve
lplkvlfaqptikalaqyva

Timeline for d2k2qa1:

• d2k2qa1 first appeared in SCOPe 2.04, called d2k2qa_
  
• d2k2qa1 appears in SCOPe 2.07