SCOPe 2.06: Domain d2k2ca2: 2k2c A:83-137

Lineage for d2k2ca2 (2k2c A:83-137)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.93: Zinc hairpin stack [161244] (1 superfamily)
   stack of beta-hairpins; in the middle hairpins, there is HCxxCxxC motif, the first and the last residues of which contribute to the zinc-binding site on one side of hairpin, whereas the middle residues contribute to the zinc-binding site on the other side

4. Superfamily g.93.1: Zinc hairpin stack [161245] (2 families)

5. Family g.93.1.0: automated matches [254250] (1 protein)
   not a true family

6. Protein automated matches [254570] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255316] (1 PDB entry)

8. Domain d2k2ca2: 2k2c A:83-137 [242358]
   Other proteins in same PDB: d2k2ca1
   automated match to d2dkta2
   complexed with zn

Details for d2k2ca2

PDB Entry: 2k2c

PDB Description: solution nmr structure of n-terminal domain of human pirh2. northeast structural genomics consortium (nesg) target ht2a

PDB Compounds: (A:) RING finger and CHY zinc finger domain-containing protein 1

SCOPe Domain Sequences for d2k2ca2:

Sequence; same for both SEQRES and ATOM records:

>d2k2ca2 g.93.1.0 (A:83-137) automated matches {Human (Homo sapiens) [TaxId: 9606]}
geyycdichlfdkdkkqyhcencgicrigpkedffhclkcnlclamnlqgrhkci

Timeline for d2k2ca2:

• d2k2ca2 first appeared in SCOPe 2.04
  
• d2k2ca2 appears in SCOPe 2.05
  
• d2k2ca2 appears in SCOPe 2.07
  
• d2k2ca2 appears in the current release, SCOPe 2.08