![]() | Class g: Small proteins [56992] (91 folds) |
![]() | Fold g.93: Zinc hairpin stack [161244] (1 superfamily) stack of beta-hairpins; in the middle hairpins, there is HCxxCxxC motif, the first and the last residues of which contribute to the zinc-binding site on one side of hairpin, whereas the middle residues contribute to the zinc-binding site on the other side |
![]() | Superfamily g.93.1: Zinc hairpin stack [161245] (2 families) ![]() |
![]() | Family g.93.1.0: automated matches [254250] (1 protein) not a true family |
![]() | Protein automated matches [254570] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255316] (1 PDB entry) |
![]() | Domain d2k2ca2: 2k2c A:83-137 [242358] Other proteins in same PDB: d2k2ca1 automated match to d2dkta2 complexed with zn |
PDB Entry: 2k2c (more details)
SCOPe Domain Sequences for d2k2ca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k2ca2 g.93.1.0 (A:83-137) automated matches {Human (Homo sapiens) [TaxId: 9606]} geyycdichlfdkdkkqyhcencgicrigpkedffhclkcnlclamnlqgrhkci
Timeline for d2k2ca2: