SCOPe 2.07: Domain d2k2ca1: 2k2c A:1-82

Lineage for d2k2ca1 (2k2c A:1-82)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.89: CHY zinc finger-like [161218] (1 superfamily)
   trimetal-bound fold; integration of HIT/MYND-like and rubredoxin-like fingers

4. Superfamily g.89.1: CHY zinc finger-like [161219] (1 family)

5. Family g.89.1.1: CHY zinc finger [161220] (2 proteins)
   Pfam PF05495

6. Protein automated matches [254569] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255315] (1 PDB entry)

8. Domain d2k2ca1: 2k2c A:1-82 [242357]
   Other proteins in same PDB: d2k2ca2
   automated match to d2dkta1
   complexed with zn

Details for d2k2ca1

PDB Entry: 2k2c

PDB Description: solution nmr structure of n-terminal domain of human pirh2. northeast structural genomics consortium (nesg) target ht2a

PDB Compounds: (A:) RING finger and CHY zinc finger domain-containing protein 1

SCOPe Domain Sequences for d2k2ca1:

Sequence; same for both SEQRES and ATOM records:

>d2k2ca1 g.89.1.1 (A:1-82) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maataredgatgeergqrgcehydrgcllkapccdklytcrlchdnnedhqldrfkvkev
qcincekiqhaqqtceecstlf

Timeline for d2k2ca1:

• d2k2ca1 first appeared in SCOPe 2.04
  
• d2k2ca1 appears in SCOPe 2.06
  
• d2k2ca1 appears in the current release, SCOPe 2.08