Lineage for d2k2aa_ (2k2a A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711591Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2711592Protein automated matches [190513] (36 species)
    not a true protein
  7. 2711760Species Lethocerus indicus [TaxId:212017] [255277] (2 PDB entries)
  8. 2711761Domain d2k2aa_: 2k2a A: [242356]
    automated match to d1f71a_

Details for d2k2aa_

PDB Entry: 2k2a (more details)

PDB Description: solution structure of the apo c terminal domain of lethocerus troponin c isoform f1
PDB Compounds: (A:) troponin c

SCOPe Domain Sequences for d2k2aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k2aa_ a.39.1.0 (A:) automated matches {Lethocerus indicus [TaxId: 212017]}
mqqelreafrlydkegngyistdvmreilaeldetlssedldamideidadgsgtvdfee
fmgvmtggde

SCOPe Domain Coordinates for d2k2aa_:

Click to download the PDB-style file with coordinates for d2k2aa_.
(The format of our PDB-style files is described here.)

Timeline for d2k2aa_: