| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
| Protein automated matches [190513] (36 species) not a true protein |
| Species Lethocerus indicus [TaxId:212017] [255277] (2 PDB entries) |
| Domain d2k2aa_: 2k2a A: [242356] automated match to d1f71a_ |
PDB Entry: 2k2a (more details)
SCOPe Domain Sequences for d2k2aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k2aa_ a.39.1.0 (A:) automated matches {Lethocerus indicus [TaxId: 212017]}
mqqelreafrlydkegngyistdvmreilaeldetlssedldamideidadgsgtvdfee
fmgvmtggde
Timeline for d2k2aa_: