SCOPe 2.08: Domain d2k28a1: 2k28 A:3-60

Lineage for d2k28a1 (2k28 A:3-60)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.2: Chromo domain [54165] (8 proteins)
   lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold

6. Protein automated matches [191035] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188859] (14 PDB entries)

8. Domain d2k28a1: 2k28 A:3-60 [242355]
   Other proteins in same PDB: d2k28a2
   automated match to d2dnta1

Details for d2k28a1

PDB Entry: 2k28

PDB Description: solution nmr structure of the chromo domain of the chromobox protein homolog 4

PDB Compounds: (A:) E3 SUMO-protein ligase CBX4

SCOPe Domain Sequences for d2k28a1:

Sequence; same for both SEQRES and ATOM records:

>d2k28a1 b.34.13.2 (A:3-60) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehvfavesiekkrirkgrveylvkwrgwspkyntwepeenildprlliafqnrerqeq

Timeline for d2k28a1:

• d2k28a1 first appeared in SCOPe 2.04, called d2k28a_
  
• d2k28a1 appears in SCOPe 2.07