SCOPe 2.06: Domain d2k1za_: 2k1z A:

Lineage for d2k1za_ (2k1z A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (8 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187666] (10 PDB entries)

8. Domain d2k1za_: 2k1z A: [242352]
   automated match to d4h11a_

Details for d2k1za_

PDB Entry: 2k1z

PDB Description: solution structure of par-3 pdz3

PDB Compounds: (A:) Partitioning-defective 3 homolog

SCOPe Domain Sequences for d2k1za_:

Sequence; same for both SEQRES and ATOM records:

>d2k1za_ b.36.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gtrefltfevplndsgsaglgvsvkgnrskenhadlgifvksiinggaaskdgrlrvndq
liavngesllgkanqeametlrrsmstegnkrgmiqlivarris

Timeline for d2k1za_:

• d2k1za_ first appeared in SCOPe 2.04
  
• d2k1za_ appears in SCOPe 2.05
  
• d2k1za_ appears in SCOPe 2.07
  
• d2k1za_ appears in the current release, SCOPe 2.08