![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
![]() | Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) ![]() |
![]() | Family b.11.1.0: automated matches [191607] (1 protein) not a true family |
![]() | Protein automated matches [191109] (11 species) not a true protein |
![]() | Species Methanosarcina acetivorans [TaxId:2214] [232522] (3 PDB entries) |
![]() | Domain d2k1xa1: 2k1x A:2-85 [242351] Other proteins in same PDB: d2k1xa2 automated match to d3hz2a_ |
PDB Entry: 2k1x (more details)
SCOPe Domain Sequences for d2k1xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k1xa1 b.11.1.0 (A:2-85) automated matches {Methanosarcina acetivorans [TaxId: 2214]} naaevivyehvnfggksfdatsdqpgagdnlndkissikvksgtwrfyeyinyggrywdl gpgeyssvesagipdnsissfrqi
Timeline for d2k1xa1: