Lineage for d2k1xa1 (2k1x A:2-85)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773464Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2773465Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2773616Family b.11.1.0: automated matches [191607] (1 protein)
    not a true family
  6. 2773617Protein automated matches [191109] (11 species)
    not a true protein
  7. 2773693Species Methanosarcina acetivorans [TaxId:2214] [232522] (3 PDB entries)
  8. 2773699Domain d2k1xa1: 2k1x A:2-85 [242351]
    Other proteins in same PDB: d2k1xa2
    automated match to d3hz2a_

Details for d2k1xa1

PDB Entry: 2k1x (more details)

PDB Description: nmr solution structure of m-crystallin in calcium free form (apo).
PDB Compounds: (A:) Beta/gama crystallin family protein

SCOPe Domain Sequences for d2k1xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k1xa1 b.11.1.0 (A:2-85) automated matches {Methanosarcina acetivorans [TaxId: 2214]}
naaevivyehvnfggksfdatsdqpgagdnlndkissikvksgtwrfyeyinyggrywdl
gpgeyssvesagipdnsissfrqi

SCOPe Domain Coordinates for d2k1xa1:

Click to download the PDB-style file with coordinates for d2k1xa1.
(The format of our PDB-style files is described here.)

Timeline for d2k1xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2k1xa2