SCOPe 2.04: Domain d2k1wa_: 2k1w A:

Lineage for d2k1wa_ (2k1w A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.0: automated matches [191607] (1 protein)
   not a true family

6. Protein automated matches [191109] (9 species)
   not a true protein

7. Species Methanosarcina acetivorans [TaxId:2214] [232522] (3 PDB entries)

8. Domain d2k1wa_: 2k1w A: [242350]
   automated match to d3hz2a_
   complexed with ca

Details for d2k1wa_

PDB Entry: 2k1w

PDB Description: nmr solution structure of m-crystallin in calcium loaded form(holo).

PDB Compounds: (A:) Beta/gama crystallin family protein

SCOPe Domain Sequences for d2k1wa_:

Sequence; same for both SEQRES and ATOM records:

>d2k1wa_ b.11.1.0 (A:) automated matches {Methanosarcina acetivorans [TaxId: 2214]}
mnaaevivyehvnfggksfdatsdqpgagdnlndkissikvksgtwrfyeyinyggrywd
lgpgeyssvesagipdnsissfrqi

Timeline for d2k1wa_:

• d2k1wa_ is new in SCOPe 2.04-stable
  
• d2k1wa_ appears in SCOPe 2.05
  
• d2k1wa_ appears in the current release, SCOPe 2.08, called d2k1wa1