SCOP 1.67: Domain d1c4rg_: 1c4r G:

Lineage for d1c4rg_ (1c4r G:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families)

5. Family b.29.1.4: Laminin G-like module [49944] (5 proteins)

6. Protein Ligand-binding domain of neurexin 1beta [49949] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [49950] (1 PDB entry)

8. Domain d1c4rg_: 1c4r G: [24235]

Details for d1c4rg_

PDB Entry: 1c4r, 2.6 Å

PDB Description: the structure of the ligand-binding domain of neurexin 1beta: regulation of lns domain function by alternative splicing

SCOP Domain Sequences for d1c4rg_:

Sequence; same for both SEQRES and ATOM records:

>d1c4rg_ b.29.1.4 (G:) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus)}
ghagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdyle
lhihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypa
grqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlvge
vp

Timeline for d1c4rg_:

• d1c4rg_ first appeared (with stable ids) in SCOP 1.55
  
• d1c4rg_ appears in SCOP 1.65
  
• d1c4rg_ appears in SCOP 1.69
  
• d1c4rg_ appears in the current release, SCOPe 2.08