![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (39 proteins) |
![]() | Protein Cardiac myosin binding protein C, different domains [89185] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89186] (5 PDB entries) Uniprot Q14896 358-451, 641-770 |
![]() | Domain d2k1ma_: 2k1m A: [242346] automated match to d1pd6a_ |
PDB Entry: 2k1m (more details)
SCOPe Domain Sequences for d2k1ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k1ma_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} pepgkkpvsafskkprsvevaagspavfeaeteragvkvrwqrggsdisasnkyglateg trhtltvrevgpadqgsyaviagsskvkfdlkvie
Timeline for d2k1ma_: