SCOPe 2.05: Domain d2k0ra_: 2k0r A:

Lineage for d2k0ra_ (2k0r A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74863] (2 families)

5. Family b.1.17.0: automated matches [254248] (1 protein)
   not a true family

6. Protein automated matches [254567] (1 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:491] [255313] (1 PDB entry)

8. Domain d2k0ra_: 2k0r A: [242341]
   automated match to d1vrsc_
   mutant

Details for d2k0ra_

PDB Entry: 2k0r

PDB Description: solution structure of the c103s mutant of the n-terminal domain of dsbd from neisseria meningitidis

PDB Compounds: (A:) Thiol:disulfide interchange protein dsbD

SCOPe Domain Sequences for d2k0ra_:

Sequence; same for both SEQRES and ATOM records:

>d2k0ra_ b.1.17.0 (A:) automated matches {Neisseria meningitidis [TaxId: 491]}
maldandllppekafvpelavaddgvnvrfriadgyymyqakivgktnpadllgqpsfsk
geekedeffgrqtvyhheaqvafpyakavgepyklvltyqgsaeagvcyppvdtefdifg
ngtyhpqt

Timeline for d2k0ra_:

• d2k0ra_ first appeared in SCOPe 2.04
  
• d2k0ra_ is called d2k0ra1 in SCOPe 2.06
  
• d2k0ra_ appears in the current release, SCOPe 2.08, called d2k0ra1