![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.11: Ran binding protein zinc finger-like [90209] (2 families) ![]() contains CxxxxC-x(n)-CxxC zinc-binding site; similar to the Sec23/24 zinc finger domain |
![]() | Family g.41.11.1: Ran binding protein zinc finger-like [90210] (7 proteins) |
![]() | Protein Nuclear pore complex protein nup153 [161175] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [188480] (8 PDB entries) |
![]() | Domain d2k0ca_: 2k0c A: [242337] automated match to d3ch5b_ protein/DNA complex; protein/RNA complex; complexed with zn |
PDB Entry: 2k0c (more details)
SCOPe Domain Sequences for d2k0ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k0ca_ g.41.11.1 (A:) Nuclear pore complex protein nup153 {Norway rat (Rattus norvegicus) [TaxId: 10116]} aigtwdcdtclvqnkpeavkcvacetpkpgtgvkr
Timeline for d2k0ca_: