Lineage for d2k04a_ (2k04 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928974Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2928975Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2928976Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2929256Protein Stromal cell-derived factor-1 (SDF-1) [54150] (1 species)
  7. 2929257Species Human (Homo sapiens) [TaxId:9606] [54151] (21 PDB entries)
  8. 2929289Domain d2k04a_: 2k04 A: [242332]
    automated match to d2nwga_

Details for d2k04a_

PDB Entry: 2k04 (more details)

PDB Description: structure of sdf1 in complex with the cxcr4 n-terminus containing no sulfotyrosines
PDB Compounds: (A:) Stromal cell-derived factor 1

SCOPe Domain Sequences for d2k04a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k04a_ d.9.1.1 (A:) Stromal cell-derived factor-1 (SDF-1) {Human (Homo sapiens) [TaxId: 9606]}
kpvslsyrcpcrffeshvaranvkhlkilntpncacqivarlknnnrqvcidpklkwiqe
ylekclnk

SCOPe Domain Coordinates for d2k04a_:

Click to download the PDB-style file with coordinates for d2k04a_.
(The format of our PDB-style files is described here.)

Timeline for d2k04a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2k04c_