![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.62: Hypothetical protein YhgG [116812] (2 proteins) automatically mapped to Pfam PF09012 |
![]() | Protein automated matches [193941] (2 species) not a true protein |
![]() | Species Klebsiella pneumoniae [TaxId:72407] [255311] (1 PDB entry) |
![]() | Domain d2k02a_: 2k02 A: [242329] automated match to d4awxb_ |
PDB Entry: 2k02 (more details)
SCOPe Domain Sequences for d2k02a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k02a_ a.4.5.62 (A:) automated matches {Klebsiella pneumoniae [TaxId: 72407]} maslmevrdmlalqgrmeakqlsarlqtpqplidamlermeamgkvvrisetsegclsgs ckscpegkaacrqewwalr
Timeline for d2k02a_: