Lineage for d2k02a_ (2k02 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694324Family a.4.5.62: Hypothetical protein YhgG [116812] (2 proteins)
    automatically mapped to Pfam PF09012
  6. 2694328Protein automated matches [193941] (2 species)
    not a true protein
  7. 2694331Species Klebsiella pneumoniae [TaxId:72407] [255311] (1 PDB entry)
  8. 2694332Domain d2k02a_: 2k02 A: [242329]
    automated match to d4awxb_

Details for d2k02a_

PDB Entry: 2k02 (more details)

PDB Description: solution structure of putative ferrous iron transport protein c (feoc) of klebsiella pneumoniae
PDB Compounds: (A:) Ferrous iron transport protein C

SCOPe Domain Sequences for d2k02a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k02a_ a.4.5.62 (A:) automated matches {Klebsiella pneumoniae [TaxId: 72407]}
maslmevrdmlalqgrmeakqlsarlqtpqplidamlermeamgkvvrisetsegclsgs
ckscpegkaacrqewwalr

SCOPe Domain Coordinates for d2k02a_:

Click to download the PDB-style file with coordinates for d2k02a_.
(The format of our PDB-style files is described here.)

Timeline for d2k02a_: