Lineage for d2jzya_ (2jzy A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695233Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 2695324Family a.4.6.0: automated matches [191513] (1 protein)
    not a true family
  6. 2695325Protein automated matches [190858] (25 species)
    not a true protein
  7. 2695354Species Klebsiella pneumoniae [TaxId:573] [255310] (3 PDB entries)
  8. 2695357Domain d2jzya_: 2jzy A: [242326]
    automated match to d1gxpa_

Details for d2jzya_

PDB Entry: 2jzy (more details)

PDB Description: solution structure of c-terminal effector domain of putative two- component-system response regulator involved in copper resistance from klebsiella pneumoniae
PDB Compounds: (A:) Transcriptional regulatory protein PcoR

SCOPe Domain Sequences for d2jzya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jzya_ a.4.6.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
maatvctiadmtvdmvrrtvirsgkkihltgkeyvllelllqrtgevlprslisslvwnm
nfdsdtnvidvavrrlrskidddfepklihtvrgagyvleiree

SCOPe Domain Coordinates for d2jzya_:

Click to download the PDB-style file with coordinates for d2jzya_.
(The format of our PDB-style files is described here.)

Timeline for d2jzya_: