SCOPe 2.08: Domain d2jzva1: 2jzv A:140-245

Lineage for d2jzva1 (2jzv A:140-245)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (29 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [255309] (1 PDB entry)

8. Domain d2jzva1: 2jzv A:140-245 [242325]
   Other proteins in same PDB: d2jzva2
   automated match to d1j6ya_

Details for d2jzva1

PDB Entry: 2jzv

PDB Description: solution structure of s. aureus prsa-ppiase

PDB Compounds: (A:) Foldase protein prsA

SCOPe Domain Sequences for d2jzva1:

Sequence; same for both SEQRES and ATOM records:

>d2jzva1 d.26.1.0 (A:140-245) automated matches {Staphylococcus aureus [TaxId: 1280]}
dskkashilikvkskksdkeglddkeakqkaeeiqkevskdpskfgeiakkesmdtgsak
kdgelgyvlkgqtdkdfekalfklkdgevsevvkssfgyhiikadk

Timeline for d2jzva1:

• d2jzva1 first appeared in SCOPe 2.04, called d2jzva_
  
• d2jzva1 appears in SCOPe 2.07