Lineage for d2jzpa_ (2jzp A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1639448Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 1639449Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 1639537Protein automated matches [190067] (6 species)
    not a true protein
  7. 1639552Species Peptostreptococcus magnus [TaxId:1260] [255308] (2 PDB entries)
  8. 1639553Domain d2jzpa_: 2jzp A: [242323]
    automated match to d1hz6a_
    mutant

Details for d2jzpa_

PDB Entry: 2jzp (more details)

PDB Description: nmr solution structure of kx5q protl mutant
PDB Compounds: (A:) protein l

SCOPe Domain Sequences for d2jzpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jzpa_ d.15.7.1 (A:) automated matches {Peptostreptococcus magnus [TaxId: 1260]}
meevtikanlifangstqtaefqgtfeqatseayayadtlkqdngewtvdvadqgytlni
qfag

SCOPe Domain Coordinates for d2jzpa_:

Click to download the PDB-style file with coordinates for d2jzpa_.
(The format of our PDB-style files is described here.)

Timeline for d2jzpa_: