Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) |
Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins) |
Protein automated matches [190067] (6 species) not a true protein |
Species Peptostreptococcus magnus [TaxId:1260] [255308] (2 PDB entries) |
Domain d2jzpa_: 2jzp A: [242323] automated match to d1hz6a_ mutant |
PDB Entry: 2jzp (more details)
SCOPe Domain Sequences for d2jzpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jzpa_ d.15.7.1 (A:) automated matches {Peptostreptococcus magnus [TaxId: 1260]} meevtikanlifangstqtaefqgtfeqatseayayadtlkqdngewtvdvadqgytlni qfag
Timeline for d2jzpa_: