Lineage for d2jznc_ (2jzn C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873203Fold c.38: PTS IIb component [52727] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 6 strands, order 324156
  4. 2873204Superfamily c.38.1: PTS IIb component [52728] (2 families) (S)
  5. 2873215Family c.38.1.0: automated matches [191563] (1 protein)
    not a true family
  6. 2873216Protein automated matches [190977] (5 species)
    not a true protein
  7. 2873219Species Escherichia coli [TaxId:562] [254924] (4 PDB entries)
  8. 2873222Domain d2jznc_: 2jzn C: [242322]
    Other proteins in same PDB: d2jzna_, d2jznb_
    automated match to d1nrza_

Details for d2jznc_

PDB Entry: 2jzn (more details)

PDB Description: solution nmr structure of the productive complex between iiamannose and iibmannose of the mannose transporter of the e. coli phosphotransferase system
PDB Compounds: (C:) Mannose-specific phosphotransferase enzyme IIB component

SCOPe Domain Sequences for d2jznc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jznc_ c.38.1.0 (C:) automated matches {Escherichia coli [TaxId: 562]}
ndymviglariddrlihgqvatrwtketnvsriivvsdevaadtvrktlltqvappgvta
hvvdvakmirvynnpkyagervmllftnptdverlveggvkitsvnvggmafrqgktqvn
navsvdekdieafkklnargielevrkvstdpklkmmdliskidk

SCOPe Domain Coordinates for d2jznc_:

Click to download the PDB-style file with coordinates for d2jznc_.
(The format of our PDB-style files is described here.)

Timeline for d2jznc_: