| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.38: PTS IIb component [52727] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 6 strands, order 324156 |
Superfamily c.38.1: PTS IIb component [52728] (2 families) ![]() |
| Family c.38.1.0: automated matches [191563] (1 protein) not a true family |
| Protein automated matches [190977] (5 species) not a true protein |
| Species Escherichia coli [TaxId:562] [254924] (4 PDB entries) |
| Domain d2jznc_: 2jzn C: [242322] Other proteins in same PDB: d2jzna_, d2jznb_ automated match to d1nrza_ |
PDB Entry: 2jzn (more details)
SCOPe Domain Sequences for d2jznc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jznc_ c.38.1.0 (C:) automated matches {Escherichia coli [TaxId: 562]}
ndymviglariddrlihgqvatrwtketnvsriivvsdevaadtvrktlltqvappgvta
hvvdvakmirvynnpkyagervmllftnptdverlveggvkitsvnvggmafrqgktqvn
navsvdekdieafkklnargielevrkvstdpklkmmdliskidk
Timeline for d2jznc_: