SCOPe 2.05: Domain d1c4rd_: 1c4r D:

Lineage for d1c4rd_ (1c4r D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.4: Laminin G-like module [49944] (7 proteins)

6. Protein Ligand-binding domain of neurexin 1beta [49949] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [49950] (5 PDB entries)

8. Domain d1c4rd_: 1c4r D: [24232]

Details for d1c4rd_

PDB Entry: 1c4r, 2.6 Å

PDB Description: the structure of the ligand-binding domain of neurexin 1beta: regulation of lns domain function by alternative splicing

PDB Compounds: (D:) neurexin-I beta

SCOPe Domain Sequences for d1c4rd_:

Sequence; same for both SEQRES and ATOM records:

>d1c4rd_ b.29.1.4 (D:) Ligand-binding domain of neurexin 1beta {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdylel
hihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypag
rqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlvg

Timeline for d1c4rd_:

• d1c4rd_ first appeared (with stable ids) in SCOP 1.55
  
• d1c4rd_ appears in SCOPe 2.04
  
• d1c4rd_ appears in SCOPe 2.06
  
• d1c4rd_ appears in the current release, SCOPe 2.08