SCOPe 2.06: Domain d2jzha_: 2jzh A:

Lineage for d2jzha_ (2jzh A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.38: PTS IIb component [52727] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 6 strands, order 324156

4. Superfamily c.38.1: PTS IIb component [52728] (2 families)

5. Family c.38.1.0: automated matches [191563] (1 protein)
   not a true family

6. Protein automated matches [190977] (5 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [254924] (4 PDB entries)

8. Domain d2jzha_: 2jzh A: [242316]
   automated match to d1nrza_

Details for d2jzha_

PDB Entry: 2jzh

PDB Description: structure of iib domain of the mannose transporter of e. coli

PDB Compounds: (A:) PTS system mannose-specific EIIAB component

SCOPe Domain Sequences for d2jzha_:

Sequence; same for both SEQRES and ATOM records:

>d2jzha_ c.38.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
ndymviglariddrlihgqvatrwtketnvsriivvsdevaadtvrktlltqvappgvta
hvvdvakmirvynnpkyagervmllftnptdverlveggvkitsvnvggmafrqgktqvn
navsvdekdieafkklnargielevrkvstdpklkmmdliskidk

Timeline for d2jzha_:

• d2jzha_ first appeared in SCOPe 2.04
  
• d2jzha_ appears in SCOPe 2.05
  
• d2jzha_ appears in SCOPe 2.07
  
• d2jzha_ appears in the current release, SCOPe 2.08