SCOPe 2.08: Domain d2jzba_: 2jzb A:

Lineage for d2jzba_ (2jzb A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.3: C-terminal domain of RNA polymerase alpha subunit [47789] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.3.1: C-terminal domain of RNA polymerase alpha subunit [47790] (2 proteins)

6. Protein C-terminal domain of RNA polymerase alpha subunit [47791] (4 species)

7. Species Yersinia pseudotuberculosis [TaxId:633] [256381] (1 PDB entry)

8. Domain d2jzba_: 2jzb A: [242315]
   automated match to d3k4ga_
   protein/DNA complex; protein/RNA complex

Details for d2jzba_

PDB Entry: 2jzb

PDB Description: solution structure of the complex between e.coli nusa-ar2 and rnap- actd

PDB Compounds: (A:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d2jzba_:

Sequence; same for both SEQRES and ATOM records:

>d2jzba_ a.60.3.1 (A:) C-terminal domain of RNA polymerase alpha subunit {Yersinia pseudotuberculosis [TaxId: 633]}
fdpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikdvla
srglslgmrlenwppasiade

Timeline for d2jzba_:

• d2jzba_ first appeared in SCOPe 2.04
  
• d2jzba_ appears in SCOPe 2.07