Lineage for d2jzba_ (2jzb A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715762Superfamily a.60.3: C-terminal domain of RNA polymerase alpha subunit [47789] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 2715763Family a.60.3.1: C-terminal domain of RNA polymerase alpha subunit [47790] (2 proteins)
  6. 2715764Protein C-terminal domain of RNA polymerase alpha subunit [47791] (4 species)
  7. 2715773Species Yersinia pseudotuberculosis [TaxId:633] [256381] (1 PDB entry)
  8. 2715774Domain d2jzba_: 2jzb A: [242315]
    automated match to d3k4ga_
    protein/DNA complex; protein/RNA complex

Details for d2jzba_

PDB Entry: 2jzb (more details)

PDB Description: solution structure of the complex between e.coli nusa-ar2 and rnap- actd
PDB Compounds: (A:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d2jzba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jzba_ a.60.3.1 (A:) C-terminal domain of RNA polymerase alpha subunit {Yersinia pseudotuberculosis [TaxId: 633]}
fdpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikdvla
srglslgmrlenwppasiade

SCOPe Domain Coordinates for d2jzba_:

Click to download the PDB-style file with coordinates for d2jzba_.
(The format of our PDB-style files is described here.)

Timeline for d2jzba_: