![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.69: Plant proteinase inhibitors [100896] (1 superfamily) disulfide-rich small alpha+beta fold; topological similarity to the Ovomucoid domain III |
![]() | Superfamily g.69.1: Plant proteinase inhibitors [100897] (1 family) ![]() |
![]() | Family g.69.1.1: Plant proteinase inhibitors [57486] (4 proteins) |
![]() | Protein automated matches [254462] (2 species) not a true protein |
![]() | Species Winged tobacco (Nicotiana alata) [TaxId:4087] [254990] (3 PDB entries) |
![]() | Domain d2jyya_: 2jyy A: [242314] automated match to d1tiha_ |
PDB Entry: 2jyy (more details)
SCOPe Domain Sequences for d2jyya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jyya_ g.69.1.1 (A:) automated matches {Winged tobacco (Nicotiana alata) [TaxId: 4087]} drictncaagtkgckyfsddgtfvcegesdprnpkaaprncdpriaygicpla
Timeline for d2jyya_: