SCOPe 2.08: Domain d2jyla_: 2jyl A:

Lineage for d2jyla_ (2jyl A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)

6. Protein HIV capsid protein, dimerisation domain [47359] (3 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47360] (13 PDB entries)

8. Domain d2jyla_: 2jyl A: [242313]
   automated match to d2xt1a_
   mutant

Details for d2jyla_

PDB Entry: 2jyl

PDB Description: solution structure of a double mutant of the carboxy-terminal dimerization domain of the hiv-1 capsid protein

PDB Compounds: (A:) Capsid protein p24 (CA)

SCOPe Domain Sequences for d2jyla_:

Sequence; same for both SEQRES and ATOM records:

>d2jyla_ a.28.3.1 (A:) HIV capsid protein, dimerisation domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacqgvggpghkarvl

Timeline for d2jyla_:

• d2jyla_ first appeared in SCOPe 2.04
  
• d2jyla_ appears in SCOPe 2.07