Lineage for d2jyga_ (2jyg A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487377Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1487597Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 1487598Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)
  6. 1487604Protein HIV capsid protein, dimerisation domain [47359] (1 species)
  7. 1487605Species Human immunodeficiency virus type 1 [TaxId:11676] [47360] (14 PDB entries)
  8. 1487625Domain d2jyga_: 2jyg A: [242312]
    automated match to d2xt1a_
    mutant

Details for d2jyga_

PDB Entry: 2jyg (more details)

PDB Description: solution structure of the w184a/m185a mutant of the carboxy-terminal dimerization domain of the hiv-1 capsid protein
PDB Compounds: (A:) Capsid protein p24 (CA)

SCOPe Domain Sequences for d2jyga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jyga_ a.28.3.1 (A:) HIV capsid protein, dimerisation domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacqgvggpghkarvl

SCOPe Domain Coordinates for d2jyga_:

Click to download the PDB-style file with coordinates for d2jyga_.
(The format of our PDB-style files is described here.)

Timeline for d2jyga_: