| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
| Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
| Protein Dihydrofolate reductase, prokaryotic type [53599] (9 species) |
| Species Haloferax volcanii [TaxId:2246] [53604] (3 PDB entries) |
| Domain d2jyba_: 2jyb A: [242311] automated match to d1vdrb_ |
PDB Entry: 2jyb (more details)
SCOPe Domain Sequences for d2jyba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jyba_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Haloferax volcanii [TaxId: 2246]}
melvsvaalaenrvigrdgelpwpsipadkkqyrsrvaddpvvlgrttfesmrddlpgsa
qivmsrsersfsvdtahraasveeavdiaasldaetayviggaaiyalfqphldrmvlsr
vpgeyegdtyypewdaaeweldaetdhegftlqewvrsassr
Timeline for d2jyba_: