Lineage for d2jy5a1 (2jy5 A:541-586)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696009Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2696033Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 2696034Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 2696138Protein automated matches [190533] (3 species)
    not a true protein
  7. 2696167Species Human (Homo sapiens) [TaxId:9606] [255306] (4 PDB entries)
  8. 2696171Domain d2jy5a1: 2jy5 A:541-586 [242310]
    Other proteins in same PDB: d2jy5a2, d2jy5a3
    automated match to d2dnaa1

Details for d2jy5a1

PDB Entry: 2jy5 (more details)

PDB Description: nmr structure of ubiquilin 1 uba domain
PDB Compounds: (A:) Ubiquilin-1

SCOPe Domain Sequences for d2jy5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jy5a1 a.5.2.1 (A:541-586) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qnpevrfqqqleqlsamgflnreanlqaliatggdinaaierllgs

SCOPe Domain Coordinates for d2jy5a1:

Click to download the PDB-style file with coordinates for d2jy5a1.
(The format of our PDB-style files is described here.)

Timeline for d2jy5a1: