SCOPe 2.07: Domain d2jxya1: 2jxy A:278-470

Lineage for d2jxya1 (2jxy A:278-470)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
   consists of four 4-stranded beta-sheet motifs; meander

4. Superfamily b.66.1: Hemopexin-like domain [50923] (2 families)

5. Family b.66.1.0: automated matches [196610] (1 protein)
   not a true family

6. Protein automated matches [196611] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [196612] (9 PDB entries)

8. Domain d2jxya1: 2jxy A:278-470 [242309]
   Other proteins in same PDB: d2jxya2
   automated match to d1rtga_
   complexed with ca

Details for d2jxya1

PDB Entry: 2jxy

PDB Description: solution structure of the hemopexin-like domain of mmp12

PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d2jxya1:

Sequence; same for both SEQRES and ATOM records:

>d2jxya1 b.66.1.0 (A:278-470) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epalcdpnlsfdavttvgnkifffkdrffwlkvserpktsvnlisslwptlpsgieaaye
iearnqvflfkddkywlisnlrpepnypksihsfgfpnfvkkidaavfnprfyrtyffvd
nqywryderrqmmdpgypklitknfqgigpkidavfysknkyyyffqgsnqfeydfllqr
itktlksnswfgc

Timeline for d2jxya1:

• d2jxya1 first appeared in SCOPe 2.04, called d2jxya_
  
• d2jxya1 appears in SCOPe 2.06
  
• d2jxya1 appears in the current release, SCOPe 2.08