SCOPe 2.07: Domain d2jxxa_: 2jxx A:

Lineage for d2jxxa_ (2jxx A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (152 PDB entries)

8. Domain d2jxxa_: 2jxx A: [242308]
   automated match to d2eked_

Details for d2jxxa_

PDB Entry: 2jxx

PDB Description: nmr solution structure of ubiquitin-like domain of nfatc2ip. northeast structural genomics consortium target hr5627

PDB Compounds: (A:) NFATC2-interacting protein

SCOPe Domain Sequences for d2jxxa_:

Sequence; same for both SEQRES and ATOM records:

>d2jxxa_ d.15.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tetsqqlqlrvqgkekhqtlevslsrdsplktlmshyeeamglsgrklsfffdgtklsgr
elpadlgmesgdlievwg

Timeline for d2jxxa_:

• d2jxxa_ first appeared in SCOPe 2.04
  
• d2jxxa_ appears in SCOPe 2.06
  
• d2jxxa_ appears in the current release, SCOPe 2.08