SCOPe 2.06: Domain d2jxoa1: 2jxo A:150-240

Lineage for d2jxoa1 (2jxo A:150-240)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187785] (40 PDB entries)

8. Domain d2jxoa1: 2jxo A:150-240 [242307]
   Other proteins in same PDB: d2jxoa2
   automated match to d1gq5a_

Details for d2jxoa1

PDB Entry: 2jxo

PDB Description: structure of the second pdz domain of nherf-1

PDB Compounds: (A:) Ezrin-radixin-moesin-binding phosphoprotein 50

SCOPe Domain Sequences for d2jxoa1:

Sequence; same for both SEQRES and ATOM records:

>d2jxoa1 b.36.1.1 (A:150-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lrprlctmkkgpsgygfnlhsdkskpgqfirsvdpdspaeasglraqdrivevngvcmeg
kqhgdvvsairaggdetkllvvdretdeffk

Timeline for d2jxoa1:

• d2jxoa1 first appeared in SCOPe 2.04, called d2jxoa_
  
• d2jxoa1 was called d2jxoa_ in SCOPe 2.05
  
• d2jxoa1 appears in SCOPe 2.07
  
• d2jxoa1 appears in the current release, SCOPe 2.08