| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) ![]() formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
| Family a.43.1.11: PutA pre-N-terminal region-like [158485] (2 proteins) in PutA it forms a separate ribbon-helix-helix domain connected to the N-terminal enzymatic domain by a flexible linker |
| Protein automated matches [190663] (2 species) not a true protein |
| Species Pseudomonas putida [TaxId:303] [255305] (3 PDB entries) |
| Domain d2jxia_: 2jxi A: [242304] automated match to d2gpeb_ |
PDB Entry: 2jxi (more details)
SCOPe Domain Sequences for d2jxia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jxia_ a.43.1.11 (A:) automated matches {Pseudomonas putida [TaxId: 303]}
matttlgvklddptrerlkaaaqsidrtphwlikqaifnylekle
Timeline for d2jxia_: