![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) ![]() formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
![]() | Family a.43.1.11: PutA pre-N-terminal region-like [158485] (2 proteins) in PutA it forms a separate ribbon-helix-helix domain connected to the N-terminal enzymatic domain by a flexible linker |
![]() | Protein automated matches [190663] (2 species) not a true protein |
![]() | Species Pseudomonas putida [TaxId:303] [255305] (3 PDB entries) |
![]() | Domain d2jxhb_: 2jxh B: [242303] automated match to d2gpeb_ |
PDB Entry: 2jxh (more details)
SCOPe Domain Sequences for d2jxhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jxhb_ a.43.1.11 (B:) automated matches {Pseudomonas putida [TaxId: 303]} matttlgvklddptrerlkaaaqsidrtphwlikqaifnylekle
Timeline for d2jxhb_: