Lineage for d2jxhb_ (2jxh B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712590Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 2712591Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 2712770Family a.43.1.11: PutA pre-N-terminal region-like [158485] (2 proteins)
    in PutA it forms a separate ribbon-helix-helix domain connected to the N-terminal enzymatic domain by a flexible linker
  6. 2712781Protein automated matches [190663] (2 species)
    not a true protein
  7. 2712787Species Pseudomonas putida [TaxId:303] [255305] (3 PDB entries)
  8. 2712791Domain d2jxhb_: 2jxh B: [242303]
    automated match to d2gpeb_

Details for d2jxhb_

PDB Entry: 2jxh (more details)

PDB Description: solution structure of dna binding domain of proline utilization a (puta) for psuedomonas putida
PDB Compounds: (B:) proline dehydrogenase

SCOPe Domain Sequences for d2jxhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jxhb_ a.43.1.11 (B:) automated matches {Pseudomonas putida [TaxId: 303]}
matttlgvklddptrerlkaaaqsidrtphwlikqaifnylekle

SCOPe Domain Coordinates for d2jxhb_:

Click to download the PDB-style file with coordinates for d2jxhb_.
(The format of our PDB-style files is described here.)

Timeline for d2jxhb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2jxha_